Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016995 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016995, RRID:AB_1852387
- Product name
- Anti-ISY1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EQEYEKKLRAELVEKWKAEREARLARGEKEEEEEE
EEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHV
PVPSQQEIEEALVRRKKMELLQKYASETLQAQSEE
ARR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes
De I, Bessonov S, Hofele R, dos Santos K, Will C, Urlaub H, Lührmann R, Pena V
Nature Structural & Molecular Biology 2015 January;22(2):138-144
Nature Structural & Molecular Biology 2015 January;22(2):138-144
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows nuclear positivity in germinal and non germinal center.
- Sample type
- HUMAN