HPA013332

CDRT1 antibody from Sigma-Aldrich
FBXW10B, FBXW10P1, HREP, SM25H2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013332, RRID:AB_1848471
Product name
Anti-CDRT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013332
Antibody type
Polyclonal
Antigen
CMT1A duplicated region transcript 1 protein
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNFFNGNCMKVIKANGRGDPVLSFFIQGNRISVCH
ISTFAKRINVGWNGIEPSATAQGGNASLTECAHVR
LH
Storage
-20C
Provider Type Product Number
- No reagents -