Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 500-M121 - Provider product page

- Provider
- PeproTech Inc.
- Product name
- Anti-Human BMP-4
- Antibody type
- Monoclonal
- Antigen
- 120-05
- Description
- Produced in mice using highly pure (>98%) recombinant human BMP-4 as the immunizing antigen. This IgG2bK antibody was purified from cell culture by Protein G affinity chromatography.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPP
GYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVN
SSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEM
VVEGCGCR- Vial size
- 50µg, 100µg, 1mg
No comments: Submit comment
No validations: Submit validation data