Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002119-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002119-M01, RRID:AB_565708
- Product name
- ETV5 monoclonal antibody (M01), clone 3B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ETV5.
- Antigen sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSE
QRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEP
IVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHG
FQSPM- Isotype
- IgG
- Antibody clone number
- 3B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer.
Helgeson BE, Tomlins SA, Shah N, Laxman B, Cao Q, Prensner JR, Cao X, Singla N, Montie JE, Varambally S, Mehra R, Chinnaiyan AM
Cancer research 2008 Jan 1;68(1):73-80
Cancer research 2008 Jan 1;68(1):73-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ETV5 monoclonal antibody (M01), clone 3B10 Western Blot analysis of ETV5 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ETV5 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol