Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002119-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002119-M02, RRID:AB_565710
- Product name
- ETV5 monoclonal antibody (M02), clone 7C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ETV5.
- Antigen sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSE
QRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEP
IVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHG
FQSPM- Isotype
- IgG
- Antibody clone number
- 7C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor.
Cyclin D1 enhances the response to estrogen and progesterone by regulating progesterone receptor expression.
Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer.
Lu G, Zhang Q, Huang Y, Song J, Tomaino R, Ehrenberger T, Lim E, Liu W, Bronson RT, Bowden M, Brock J, Krop IE, Dillon DA, Gygi SP, Mills GB, Richardson AL, Signoretti S, Yaffe MB, Kaelin WG Jr
Cancer cell 2014 Aug 11;26(2):222-34
Cancer cell 2014 Aug 11;26(2):222-34
Cyclin D1 enhances the response to estrogen and progesterone by regulating progesterone receptor expression.
Yang C, Chen L, Li C, Lynch MC, Brisken C, Schmidt EV
Molecular and cellular biology 2010 Jun;30(12):3111-25
Molecular and cellular biology 2010 Jun;30(12):3111-25
Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer.
Helgeson BE, Tomlins SA, Shah N, Laxman B, Cao Q, Prensner JR, Cao X, Singla N, Montie JE, Varambally S, Mehra R, Chinnaiyan AM
Cancer research 2008 Jan 1;68(1):73-80
Cancer research 2008 Jan 1;68(1):73-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ETV5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
