HPA031430

ZNF512 antibody from MilliporeSigma / Merck KGaA
KIAA1805
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031430
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031430, RRID:AB_10603844
Product name
Anti-ZNF512 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031430
Antibody type
Polyclonal
Antigen
zinc finger protein 512 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKTQPNPKSQARRIRKEPPVYAAGSLEEQWYLEIV
DKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTC
HHCGKQLRSLAGMKYHVMANH
Storage
-20C
Provider Type Product Number
- No reagents -