Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- M3895-07F - Provider product page
- Provider
- United States Biological
- Product name
- Migration Inhibitory Factor (Macrophage MIF, Glycosylation-Inhibiting Factor, GIF, GLIF, MMIF)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa2-32 of Human MIF (KLH coupled). Peptide sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATG
- Description
- Purified by selective precipitation and salt fractionation followed by extensive dialysis. Endotoxin:
- Host
- Chicken/Avian
- Isotype
- IgY
- Vial size
- 500µg
- Concentration
- ~5mg/ml (after reconstitution)
- Storage
- 4°C (-20°C Glycerol)
No comments: Submit comment
No validations: Submit validation data