Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004282-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004282-M01, RRID:AB_464168
- Product name
- MIF monoclonal antibody (M01), clone 2A10-4D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MIF.
- Antigen sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPP
QYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAA
NVGWNNSTFA- Isotype
- IgG
- Antibody clone number
- 2A10-4D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references An HLA-presented fragment of macrophage migration inhibitory factor is a therapeutic target for invasive breast cancer.
eIF3m expression influences the regulation of tumorigenesis-related genes in human colon cancer.
Hawkins O, Verma B, Lightfoot S, Jain R, Rawat A, McNair S, Caseltine S, Mojsilovic A, Gupta P, Neethling F, Almanza O, Dooley W, Hildebrand W, Weidanz J
Journal of immunology (Baltimore, Md. : 1950) 2011 Jun 1;186(11):6607-16
Journal of immunology (Baltimore, Md. : 1950) 2011 Jun 1;186(11):6607-16
eIF3m expression influences the regulation of tumorigenesis-related genes in human colon cancer.
Goh SH, Hong SH, Hong SH, Lee BC, Ju MH, Jeong JS, Cho YR, Kim IH, Lee YS
Oncogene 2011 Jan 27;30(4):398-409
Oncogene 2011 Jan 27;30(4):398-409
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody (M01), clone 2A10-4D3.Lane 1: MIF transfected lysate(12.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MIF is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MIF MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol