HPA003868

MIF antibody from Sigma-Aldrich
GIF, GLIF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003868
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003868, RRID:AB_1079290
Product name
Anti-MIF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003868
Antibody type
Polyclonal
Antigen
Macrophage migration inhibitory factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYI
AVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQN
RSYSKLLCGLLAERLRISPDRVYINYYDMNAANVG
WNN
Storage
-20C
Provider Type Product Number
- No reagents -