HPA019511

SLIT2 antibody from Sigma-Aldrich
SLIL3, Slit-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019511
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019511, RRID:AB_1857226
Product name
Anti-SLIT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019511
Antibody type
Polyclonal
Antigen
Slit homolog 2 protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAIYSVETINDGNFHIVELLALDQSLSLSVDGGNP
KIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQA
PGQNGTSFHGRIWN
Storage
-20C
Provider Type Product Number
- No reagents -