H00001595-A01
antibody from Abnova Corporation
Targeting: CYP51A1
CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001595-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001595-A01, RRID:AB_875526
- Product name
- CYP51A1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CYP51A1.
- Antigen sequence
SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFA
YVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFD
LIDGYFPTVNYTTMIHTPENPVIRYKRRSK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Amyloid precursor protein α- and β-cleaved ectodomains exert opposing control of cholesterol homeostasis via SREBP2.
Variation of cholesterol contents in porcine cumulus-oocyte complexes is a key factor in regulation of fertilizing capacity.
Wang W, Mutka AL, Zmrzljak UP, Rozman D, Tanila H, Gylling H, Remes AM, Huttunen HJ, Ikonen E
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Feb;28(2):849-60
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Feb;28(2):849-60
Variation of cholesterol contents in porcine cumulus-oocyte complexes is a key factor in regulation of fertilizing capacity.
Watanabe H, Hirai S, Tateno H, Fukui Y
Theriogenology 2013 Mar 1;79(4):680-6
Theriogenology 2013 Mar 1;79(4):680-6
No comments: Submit comment
No validations: Submit validation data