HPA043508

antibody from Atlas Antibodies

Targeting: CYP51A1 CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1

Antibody data

Submit

Validation data

Product number: HPA043508 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043508, RRID:AB_2678520
Product name: Anti-CYP51A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYL LGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGV AYDVPNPVFLEQKKML
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYP51A1 protein structure - HPA043508 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-CYP51A1 antibody HPA043508 (A) shows similar protein distribution across tissues to independent antibody HPA041325 (B).
Antibody #2 product nr: HPA041325
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CYP51A1 antibody HPA043508.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CYP51A1 antibody HPA043508.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CYP51A1 antibody HPA043508.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CYP51A1 antibody HPA043508.
Sample type: HUMAN