HPA049402

HYAL3 antibody from Atlas Antibodies
LUCA-3, LUCA14, Minna14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA049402
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049402, RRID:AB_2680746
Product name
Anti-HYAL3
Provider product page
Atlas Antibodies - HPA049402
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRR
RAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAA
RALMEDTLRVAQALR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -