H00003080-B01P

CFHR2 antibody from Abnova Corporation
CFHL2, FHR2, HFL3

Antibody data

Product number
H00003080-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003080-B01P, RRID:AB_1573041
Product name
CFHR2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00003080-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CFHR2 protein.
Antigen sequence
EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYY
SCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCF
FPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNN
ENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNG
DITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCR
NGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQK
LYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLV
YPSCEEK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -