HPA027051

TMEM199 antibody from Sigma-Aldrich
C17orf32, MGC45714, VMA12, VPH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027051
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027051, RRID:AB_10600915
Product name
Anti-TMEM199 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027051
Antibody type
Polyclonal
Antigen
transmembrane protein 199 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGERLVRALGPGGELEPERLPRKLRAELEAALGKK
HKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYL
HELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLA
NEEYKRITRNVTCQDTRHGGTLSDLGKQVRSL
Storage
-20C
Provider Type Product Number
- No reagents -