HPA000525

ADSL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000525
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000525, RRID:AB_1078106
Product name
Anti-ADSL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000525
Antibody type
Polyclonal
Antigen
Adenylosuccinate lyase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRICLAEAFLTADTILNTLQNISEGLVVYPKVIER
RIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVL
SQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLD
HLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVM
KVKA
Storage
-20C
Provider Type Product Number
- No reagents -