HPA013846

HLA-DOB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013846
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013846, RRID:AB_1853928
Product name
Anti-HLA-DOB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013846
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DO beta chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGM
FVALIKLGQPDAEQWNSRLDLLERSRQAVDGVCRH
NYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLH
CSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNG
D
Storage
-20C
Provider Type Product Number
- No reagents -