Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026140-B02P - Provider product page

- Provider
- Abnova Corporation
- Product name
- TTLL3 purified MaxPab mouse polyclonal antibody (B02P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human TTLL3 protein.
- Antigen sequence
TEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVN
GNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFL
VTDWNPLTVWFYRDSYIRFSTQPFSLKNLDK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TTLL3 expression in transfected 293T cell line (H00026140-T03) by TTLL3 MaxPab polyclonal antibody.Lane 1: TTLL3 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to TTLL3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to TTLL3 on 293 cell. [antibody concentration 1 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol