Antibody data

Product number
H00050814-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00050814-M01, RRID:AB_509229
Product name
NSDHL monoclonal antibody (M01), clone 6E3
Provider product page
Abnova Corporation - H00050814-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NSDHL.
Antigen sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQN
QAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQ
QGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCA
SPPPS
Isotype
IgG
Antibody clone number
6E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -