H00050814-D01

NSDHL antibody from Abnova Corporation
H105e3, SDR31E1, XAP104

Antibody data

Product number
H00050814-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00050814-D01, RRID:AB_10720106
Product name
NSDHL MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00050814-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human NSDHL protein.
Antigen sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQN
QAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQ
QGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCA
SPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKL
ILTSSASVIFEGVDIKNGTEDLPYAMKPIDYYTET
KILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQ
LVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVH
GHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLS
RILTGLNYEAPKYHIPYWVAYYLALLLSLLVMVIS
PVIQLQPTFTPMRVALAGTFHYYSCERAKKAMGYQ
PLVTMDDAMERTVQSFRHLRRVK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -