HPA000248

NSDHL antibody from Atlas Antibodies
H105e3, SDR31E1, XAP104
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000248
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000248, RRID:AB_1079507
Product name
Anti-NSDHL
Provider product page
Atlas Antibodies - HPA000248
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQN
QAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQ
QGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCA
SPPPSSNNKELFYRVNYIGT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -