HPA000571

NSDHL antibody from Atlas Antibodies
H105e3, SDR31E1, XAP104
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000571
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000571, RRID:AB_611667
Product name
Anti-NSDHL
Provider product page
Atlas Antibodies - HPA000571
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTT
AIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNG
KNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFH
ITNDEPIPFWTFLSRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -