HPA000248

NSDHL antibody from Sigma-Aldrich
H105e3, SDR31E1, XAP104
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000248, RRID:AB_1079507
Product name
Anti-NSDHL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000248
Antibody type
Polyclonal
Antigen
Sterol-4alpha-carboxylate 3-dehydrogenase, decarboxylating recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQN
QAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQ
QGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCA
SPPPSSNNKELFYRVNYIGT
Storage
-20C
Provider Type Product Number
- No reagents -