Antibody data

Product number
H00008637-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008637-M11, RRID:AB_1204309
Product name
EIF4EBP3 monoclonal antibody (M11), clone 1E3
Provider product page
Abnova Corporation - H00008637-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP3.
Antigen sequence
MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGG
TRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP
PTAPLSKLEELKEQETEEEIPDDAQFEMDI
Isotype
IgG
Antibody clone number
1E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -