Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001099 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-PDXP
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FAKLREACAHLRDPECLLVATDRDPWHPLSDGSRT
PGTGSLAAAVETASGRQALVVGKPSPYMFECITEN
FSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTG
VSRLEEAQAYLAAGQHDLVPHYYVESIADLTE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references PLPP/CIN-mediated NF2 S10 dephosphorylation distinctly regulates kainate-induced seizure susceptibility and neuronal death through PAK1-NF-κB-COX-2-PTGES2 signaling pathway
Metabolic enzymes expressed by cancer cells impact the immune infiltrate.
Kim J, Lee D, Kim T, Park H, Kim M, Kang T
Journal of Neuroinflammation 2023;20(1)
Journal of Neuroinflammation 2023;20(1)
Metabolic enzymes expressed by cancer cells impact the immune infiltrate.
Stoll G, Kremer M, Bloy N, Joseph A, Castedo M, Meurice G, Klein C, Galluzzi L, Michels J, Kroemer G
Oncoimmunology 2019;8(6):e1571389
Oncoimmunology 2019;8(6):e1571389
No comments: Submit comment
No validations: Submit validation data