HPA001099

PDXP antibody from Sigma-Aldrich
CIN, dJ37E16.5, FLJ32703
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001099
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001099, RRID:AB_1079590
Product name
Anti-PDXP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001099
Antibody type
Polyclonal
Antigen
Pyridoxal phosphate phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAKLREACAHLRDPECLLVATDRDPWHPLSDGSRT
PGTGSLAAAVETASGRQALVVGKPSPYMFECITEN
FSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTG
VSRLEEAQAYLAAGQHDLVPHYYVESIADLTE
Storage
-20C
Provider Type Product Number
- No reagents -