HPA019654

CNTF antibody from Atlas Antibodies
HCNTF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019654
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019654, RRID:AB_1859050
Product name
Anti-CNTF
Provider product page
Atlas Antibodies - HPA019654
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEA
DGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIH
DLRFISSHQTGIPARGSHYIANNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -