HPA019654

CNTF antibody from MilliporeSigma / Merck KGaA
HCNTF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019654
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019654, RRID:AB_1859050
Product name
Anti-ZFP91 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019654
Antibody type
Polyclonal
Antigen
Ciliary neurotrophic factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEA
DGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIH
DLRFISSHQTGIPARGSHYIANNK
Storage
-20C
Provider Type Product Number
- No reagents -