HPA005944

LY6G5B antibody from Sigma-Aldrich
C6orf19, G5b
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005944
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005944, RRID:AB_1847290
Product name
Anti-CSNK2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005944
Antibody type
Polyclonal
Antigen
Casein kinase II subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEM
LYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVY
CENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKS
SRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQF
VPRLY
Storage
-20C
Provider Type Product Number
- No reagents -