HPA004731

TLR9 antibody from Sigma-Aldrich
CD289
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004731
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004731, RRID:AB_1080298
Product name
Anti-TLR9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004731
Antibody type
Polyclonal
Antigen
Toll-like receptor 9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLSLAPSFGSLVALKELDMHGIFFRSLDETTLRPL
ARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDL
SDNRISGASELTATMGEADGGEKVWLQPGDLAPAP
VDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMF
Storage
-20C
Provider Type Product Number
- No reagents -