HPA002859

PRAF2 antibody from Atlas Antibodies
JM4, Yip6a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002859
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002859, RRID:AB_1079672
Product name
Anti-PRAF2
Provider product page
Atlas Antibodies - HPA002859
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCH
RVINN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -