HPA002859

PRAF2 antibody from Sigma-Aldrich
JM4, Yip6a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002859, RRID:AB_1079672
Product name
Anti-PRAF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002859
Antibody type
Polyclonal
Antigen
PRA1 family protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCH
RVINN
Storage
-20C
Provider Type Product Number
- No reagents -