HPA000638

ARFGAP3 antibody from Sigma-Aldrich
ARFGAP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000638, RRID:AB_1078188
Product name
Anti-ARFGAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000638
Antibody type
Polyclonal
Antigen
ADP-ribosylation factor GTPase-activating protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASIT
YGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWF
QLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRA
AQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSP
PP
Storage
-20C
Provider Type Product Number
- No reagents -