HPA049854

PACSIN2 antibody from Atlas Antibodies
SDPII
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA049854
Provider
Atlas Antibodies
Product name
Anti-PACSIN2
Provider product page
Atlas Antibodies - HPA049854
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDT
KAKNVSSYEKTQSYPTDWS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -