Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunohistochemistry [1]
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000931-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000931-B01P, RRID:AB_1677975
- Product name
- MS4A1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human MS4A1 protein.
- Antigen sequence
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMS
SLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL
MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATE
KNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEK
NSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG
IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEE
VVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP
EPPQDQESSPIENDSSP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of an alternative CD20 transcript variant in B-cell malignancies coding for a novel protein associated to rituximab resistance.
Henry C, Deschamps M, Rohrlich PS, Pallandre JR, Rémy-Martin JP, Callanan M, Traverse-Glehen A, GrandClément C, Garnache-Ottou F, Gressin R, Deconinck E, Salles G, Robinet E, Tiberghien P, Borg C, Ferrand C
Blood 2010 Mar 25;115(12):2420-9
Blood 2010 Mar 25;115(12):2420-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MS4A1 MaxPab polyclonal antibody. Western Blot analysis of MS4A1 expression in human spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MS4A1 expression in transfected 293T cell line (H00000931-T01) by MS4A1 MaxPab polyclonal antibody.Lane 1: MS4A1 transfected lysate(32.67 KDa).Lane 2: Non-transfected lysate.
- Validation comment
- Western Blot (Transfected lysate)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MS4A1 expression in transfected 293T cell line (H00000931-T01) by MS4A1 MaxPab polyclonal antibody.Lane 1: MS4A1 transfected lysate(32.67 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to MS4A1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FACS analysis of negative control 293 cells (Black) and MS4A1 expressing 293 cells (Green) using MS4A1 purified MaxPab mouse polyclonal antibody.
- Validation comment
- Flow Cytometry