HPA014391

MS4A1 antibody from Sigma-Aldrich
B1, Bp35, CD20, MS4A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014391
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014391, RRID:AB_1846264
Product name
Anti-MS4A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014391
Antibody type
Polyclonal
Antigen
B-lymphocyte antigen CD20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYC
Y
Storage
-20C
Provider Type Product Number
- No reagents -