Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054749-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054749-M01, RRID:AB_425991
- Product name
- EPDR1 monoclonal antibody (M01), clone 1C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EPDR1.
- Antigen sequence
APRPCQAPQQWEGRQVMYQQSSGRNSRALLSYDGL
NQRVRVLDERKALIPCKRLFEYILLYKDGVMFQID
QATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIGGP
QEQITVQEWSDRKSARSYETWIGIYTVKDCYPVQE
TFTINYSVILSTRFFDIQLGIKDPSVFTPPSTCQM
AQLEKMSEDCSW- Isotype
- IgG
- Antibody clone number
- 1C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPDR1 monoclonal antibody (M01), clone 1C1 Western Blot analysis of EPDR1 expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EPDR1 expression in transfected 293T cell line by EPDR1 monoclonal antibody (M01), clone 1C1.Lane 1: EPDR1 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPDR1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of EPDR1 transfected lysate using anti-EPDR1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EPDR1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol