Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28017 - Provider product page

- Provider
- Abnova Corporation
- Product name
- SYF2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SYF2
- Antigen sequence
AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRK
FRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAK
KARLEWELKEEEKKKECAARG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with SYF2 polyclonal antibody (Cat # PAB28017).Lane 1: NIH-3T3Lane 2: NBT-II
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with SYF2 polyclonal antibody (Cat # PAB28017).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with SYF2 polyclonal antibody ( Cat # PAB28017 ) shows strong cytoplasmic/ nuclear and membranous positivity in cells in tubules at 1:500 - 1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)