Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003043-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003043-M02, RRID:AB_534888
- Product name
- HBB monoclonal antibody (M02), clone 7B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HBB.
- Antigen sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF
SDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLL
GNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANAL
PHKYH- Isotype
- IgG
- Antibody clone number
- 7B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A synthetic model of human beta-thalassemia erythropoiesis using CD34+ cells from healthy adult donors.
Hemoglobin α and β are ubiquitous in the human lung, decline in idiopathic pulmonary fibrosis but not in COPD.
Lee YT, Kim KS, Byrnes C, de Vasconcellos JF, Noh SJ, Rabel A, Meier ER, Miller JL
PloS one 2013;8(7):e68307
PloS one 2013;8(7):e68307
Hemoglobin α and β are ubiquitous in the human lung, decline in idiopathic pulmonary fibrosis but not in COPD.
Ishikawa N, Ohlmeier S, Salmenkivi K, Myllärniemi M, Rahman I, Mazur W, Kinnula VL
Respiratory research 2010 Sep 13;11:123
Respiratory research 2010 Sep 13;11:123
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HBB is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol