Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004267-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004267-M01, RRID:AB_489891
- Product name
- CD99 monoclonal antibody (M01), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CD99.
- Antigen sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGD
AVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSD
ADLADGVSGGEGKGGSDGGGSHRKEGEEAD- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Orbital infantile myofibroma: a case report and clinicopathologic review of 24 cases from the literature.
Mynatt CJ, Feldman KA, Thompson LD
Head and neck pathology 2011 Sep;5(3):205-15
Head and neck pathology 2011 Sep;5(3):205-15
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CD99 monoclonal antibody (M01), clone 3A10 Western Blot analysis of CD99 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CD99 expression in transfected 293T cell line by CD99 monoclonal antibody (M01), clone 3A10.Lane 1: CD99 transfected lysate(18.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CD99 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol