HPA024667

C8orf58 antibody from Atlas Antibodies
FLJ34715
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024667
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024667, RRID:AB_1845783
Product name
Anti-C8orf58
Provider product page
Atlas Antibodies - HPA024667
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGRE
ALFLKLASRDSGVEMAVGDSPLAALPGLSQDSLDF
ESSGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -