HPA024667

C8orf58 antibody from Sigma-Aldrich
FLJ34715
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024667, RRID:AB_1845783
Product name
Anti-C8orf58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024667
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGRE
ALFLKLASRDSGVEMAVGDSPLAALPGLSQDSLDF
ESSGS
Storage
-20C
Provider Type Product Number
- No reagents -