HPA028286

C8orf58 antibody from Sigma-Aldrich
FLJ34715
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028286, RRID:AB_1845784
Product name
Anti-C8orf58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028286
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPS
PLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVP
SANPPRLPET
Storage
-20C
Provider Type Product Number
- No reagents -