H00063915-B01

BLOC1S5 antibody from Abnova Corporation
dJ303A1.3, MU, MUTED

Antibody data

Product number
H00063915-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063915-B01, RRID:AB_1138691
Product name
MUTED MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00063915-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MUTED protein.
Antigen sequence
MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLI
IKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGL
REMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQV
LQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQ
HMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYA
EMEKDLAKFSTF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -