HPA001114

RAB39B antibody from Sigma-Aldrich
MRX72
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001114, RRID:AB_1079732
Product name
Anti-RAB39B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001114
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-39B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQR
QVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTD
LTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSS
EEVVKSER
Storage
-20C
Provider Type Product Number
- No reagents -