HPA019758

CEACAM5 antibody from Sigma-Aldrich
CD66e, CEA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019758
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019758, RRID:AB_1846326
Product name
Anti-CEACAM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019758
Antibody type
Polyclonal
Antigen
Carcinoembryonic antigen-related cell adhesion molecule 5 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QELFISNITEKNSGLYTCQANNSASGHSRTTVKTI
TVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
Storage
-20C
Provider Type Product Number
- No reagents -