Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010324-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010324-M01, RRID:AB_1112373
- Product name
- KBTBD10 monoclonal antibody (M01), clone 1H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KBTBD10.
- Antigen sequence
RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKD
DIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTG
AGEVNGDVGDEDLLPGYLNDIPRHGMFVKD- Isotype
- IgG
- Antibody clone number
- 1H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of KBTBD10 expression in transfected 293T cell line by KBTBD10 monoclonal antibody (M01), clone 1H3.Lane 1: KBTBD10 transfected lysate (Predicted MW: 68 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KBTBD10 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol