Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183699 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kelch Repeat and BTB (POZ) Domain Containing 10 (KBTBD10) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KBTBD10 antibody: synthetic peptide directed towards the N terminal of human KBTBD10
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDC
TLKAG DKSLPCHRLI- Vial size
- 0.1 mg
Submitted references Sarcosin (Krp1) in skeletal muscle differentiation: gene expression profiling and knockdown experiments.
Expression profiling of cardiac genes in human hypertrophic cardiomyopathy: insight into the pathogenesis of phenotypes.
du Puy L, Beqqali A, van Tol HT, Monshouwer-Kloots J, Passier R, Haagsman HP, Roelen BA
The International journal of developmental biology 2012;56(4):301-9
The International journal of developmental biology 2012;56(4):301-9
Expression profiling of cardiac genes in human hypertrophic cardiomyopathy: insight into the pathogenesis of phenotypes.
Lim DS, Roberts R, Marian AJ
Journal of the American College of Cardiology 2001 Oct;38(4):1175-80
Journal of the American College of Cardiology 2001 Oct;38(4):1175-80
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting