HPA021165

KLHL41 antibody from Sigma-Aldrich
KBTBD10, Krp1, SARCOSIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021165
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021165, RRID:AB_1852087
Product name
Anti-KBTBD10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021165
Antibody type
Polyclonal
Antigen
Kelch repeat and BTB domain-containing protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILL
VNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQ
QNQI
Storage
-20C
Provider Type Product Number
- No reagents -