Antibody data

Product number
H00129880-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00129880-B01P, RRID:AB_1571653
Product name
BBS5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00129880-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human BBS5 protein.
Antigen sequence
MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLD
SIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVS
VGYNCILNITTRTANSKLRGQTEALYILTKCNSTR
FEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDF
KLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQG
NLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIK
IRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQE
SVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALT
VEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPV
FSEELGLAIEKLKDGFTLQGLWEVMS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.